Human SCARD1(Scavenger Receptor Class D Member 1) ELISA Kit

To Order: Contact

Recombinant Scavenger Receptor Class D Member 1 (SCARD1)

4-RPB257Mu01
  • EUR 548.00
  • EUR 250.00
  • EUR 1780.00
  • EUR 660.00
  • EUR 1220.00
  • EUR 430.00
  • EUR 4300.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P31996
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 61.4kDa
  • Isoelectric Point: 8
Description: Recombinant Mouse Scavenger Receptor Class D Member 1 expressed in: E.coli

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

20-abx156733
  • EUR 7112.00
  • EUR 3792.00
  • EUR 879.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-10x96wellstestplate 10x96-wells test plate
EUR 4502.43
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-1x48wellstestplate 1x48-wells test plate
EUR 458.44
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-1x96wellstestplate 1x96-wells test plate
EUR 612.05
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

SEB257Hu-5x96wellstestplate 5x96-wells test plate
EUR 2454.23
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit

4-SEB257Hu
  • EUR 4553.00
  • EUR 2405.00
  • EUR 613.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class D Member 1 elisa. Alternative names of the recognized antigen: CD68
  • GP110
  • Macrosialin
  • Macrophage Antigen CD68
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Scavenger Receptor Class D Member 1 (SCARD1) Protein

20-abx654994
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.

Human Scavenger Receptor Class D Member 1 (SCARD1) CLIA Kit

20-abx492558
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

ELISA kit for Human SCARD1 (Scavenger Receptor Class D Member 1)

ELK5088 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class D Member 1 (SCARD1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class D Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein

20-abx167510
  • EUR 759.00
  • EUR 300.00
  • EUR 2388.00
  • EUR 913.00
  • EUR 537.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse)

4-PAB257Mu01
  • EUR 243.00
  • EUR 2457.00
  • EUR 613.00
  • EUR 305.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1)

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC

4-PAB257Mu01-APC
  • EUR 340.00
  • EUR 3203.00
  • EUR 894.00
  • EUR 432.00
  • EUR 217.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Biotinylated

4-PAB257Mu01-Biotin
  • EUR 307.00
  • EUR 2407.00
  • EUR 714.00
  • EUR 375.00
  • EUR 217.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Biotin.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Cy3

4-PAB257Mu01-Cy3
  • EUR 411.00
  • EUR 4229.00
  • EUR 1151.00
  • EUR 535.00
  • EUR 248.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Cy3.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), FITC

4-PAB257Mu01-FITC
  • EUR 292.00
  • EUR 2582.00
  • EUR 735.00
  • EUR 366.00
  • EUR 194.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with FITC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), HRP

4-PAB257Mu01-HRP
  • EUR 311.00
  • EUR 2792.00
  • EUR 791.00
  • EUR 391.00
  • EUR 205.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with HRP.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), PE

4-PAB257Mu01-PE
  • EUR 292.00
  • EUR 2582.00
  • EUR 735.00
  • EUR 366.00
  • EUR 194.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with PE.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC-Cy7

4-PAB257Mu01-APC-Cy7
  • EUR 560.00
  • EUR 6286.00
  • EUR 1669.00
  • EUR 745.00
  • EUR 315.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC-Cy7.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit

E01S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit

E04S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit

E04S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit

E04S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit

E02S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit

E03S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit

E06S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit

E06S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit

E06S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit

E08S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit

E08S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit

E08S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit

E07S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit

E07S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit

E07S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit

E09S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit

E09S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit

E09S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Scavenger Receptor Class B Member 1 (SRB1) ELISA Kit

STA-630 96 assays
EUR 618
Description: Scavenger Receptor Class B Member 1 (SRB1 or SCARB1) is a transmembrane protein that plays a critical role in the reverse cholesterol transport pathway where cholesterol is cleared from macrophages and peripheral tissues and transported to the liver. This ELISA kit provides a convenient format for the quantitation of SRB1 in human and rodent samples.

Scavenger Receptor Class B, Member 1 Antibody

20-abx115386
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class F, Member 1 Antibody

20-abx115387
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

DLR-SCARB1-Hu-48T 48T
EUR 517
  • Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

DLR-SCARB1-Hu-96T 96T
EUR 673
  • Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

20-abx153022
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx251099-96tests 96 tests
EUR 754
  • Shipped within 5-12 working days.

Human SCARB1/ Scavenger receptor class B member 1 ELISA Kit

E2215Hu 1 Kit
EUR 571

Human SCARB1(Scavenger receptor class B member 1) ELISA Kit

EH1791 96T
EUR 567.6
  • Detection range: 0.312-20 ng/ml
  • Uniprot ID: Q8WTV0
  • Alias: SCARB1/CD36L1/CLA1/HDLQTL6/SR-B1/CD36L1/CLA1 CD36 antigen-like 1/CLA-1/Collagen type I receptor, thrombospondin receptor-like 1/scavenger receptor class B type III/scavenger receptor class B,
  • Show more
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Scavenger receptor class B member 1, SCARB1 ELISA KIT

ELI-05041h 96 Tests
EUR 824

Human Scavenger receptor class F member 1, SCARF1 ELISA KIT

ELI-42496h 96 Tests
EUR 824

Human Scavenger Receptor Class F Member 1 (SCARF1) ELISA Kit

abx383040-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx575654-96tests 96 tests
EUR 754
  • Shipped within 5-12 working days.

Human Scavenger Receptor Class B Member 1(SCARB1)ELISA Kit

QY-E05103 96T
EUR 361

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

RDR-SCARB1-Hu-48Tests 48 Tests
EUR 544

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

RDR-SCARB1-Hu-96Tests 96 Tests
EUR 756

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

RD-SCARB1-Hu-48Tests 48 Tests
EUR 521

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

RD-SCARB1-Hu-96Tests 96 Tests
EUR 723

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

4-SEH194Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1
  • SRB1
  • CLA1, SR-BI
  • Collagen Type I Receptor Thrombospondin Receptor-Like 1
  • CD36 and LIMPII analogous 1
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Scavenger receptor class B member 1 (SCARB1)

1-CSB-EP845139HU
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 62.7 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Scavenger receptor class B member 1(SCARB1),partial expressed in E.coli

Guinea pig Scavenger receptor class B member 1 ELISA kit

E05S0437-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Scavenger receptor class B member 1 ELISA kit

E05S0437-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Scavenger receptor class B member 1 ELISA kit

E05S0437-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

20-abx258025
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Rat Scarb1/ Scavenger receptor class B member 1 ELISA Kit

E0869Ra 1 Kit
EUR 571

Porcine Scavenger receptor class B member 1, SCARB1 ELISA KIT

ELI-05042p 96 Tests
EUR 928

Bovine Scavenger receptor class B member 1, SCARB1 ELISA KIT

ELI-05043b 96 Tests
EUR 928

Mouse Scavenger receptor class B member 1, Scarb1 ELISA KIT

ELI-05045m 96 Tests
EUR 865

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx350522-96tests 96 tests
EUR 786
  • Shipped within 5-12 working days.

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx354092-96tests 96 tests
EUR 786
  • Shipped within 5-12 working days.

Cow Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx517702-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx517704-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Pig Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx517705-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit

abx517706-96tests 96 tests
EUR 786
  • Shipped within 5-12 working days.

Mouse Scavenger receptor class F member 1, Scarf1 ELISA KIT

ELI-41032m 96 Tests
EUR 865

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Mu-10x96wellstestplate 10x96-wells test plate
EUR 4862.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Mu-1x48wellstestplate 1x48-wells test plate
EUR 488.08
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Mu-1x96wellstestplate 1x96-wells test plate
EUR 654.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

SEH194Mu-5x96wellstestplate 5x96-wells test plate
EUR 2644.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit

4-SEH194Mu
  • EUR 4913.00
  • EUR 2595.00
  • EUR 655.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1
  • SRB1
  • CLA1, SR-BI
  • Collagen Type I Receptor Thrombospondin Receptor-Like 1
  • CD36 and LIMPII analogous 1
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species.

ELISA kit for Human SCARB1 (Scavenger receptor class B member 1)

E-EL-H2363 1 plate of 96 wells
EUR 534
  • Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human SCARB1 (Scavenger Receptor Class B Member 1)

ELK3751 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)

KTE60746-48T 48T
EUR 332
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)

KTE60746-5platesof96wells 5 plates of 96 wells
EUR 2115
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)

KTE60746-96T 96T
EUR 539
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx178315
  • EUR 1205.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody

20-abx218449
  • EUR 425.00
  • EUR 342.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx210885
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx210886
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx125395
  • EUR 592.00
  • EUR 857.00
  • EUR 411.00
  • 100 ul
  • 200 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx130372
  • EUR 453.00
  • EUR 133.00
  • EUR 1302.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx174462
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

abx031121-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

abx031121-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody

abx237624-100ug 100 ug
EUR 509
  • Shipped within 5-12 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx339690
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx339799
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

abx430750-200ul 200 ul
EUR 384
  • Shipped within 1-3 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

abx430751-200ul 200 ul
EUR 384
  • Shipped within 1-3 working days.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody

abx430752-200ul 200 ul
EUR 384
  • Shipped within 1-3 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx301579
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody

20-abx001334
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.

Recombinant Scavenger Receptor Class B Member 1 (SCARB1)

4-RPH194Ra01
  • EUR 510.37
  • EUR 239.00
  • EUR 1638.88
  • EUR 612.96
  • EUR 1125.92
  • EUR 404.00
  • EUR 3947.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P97943
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 74.8kDa
  • Isoelectric Point: Inquire
Description: Recombinant Rat Scavenger Receptor Class B Member 1 expressed in: E.coli

Human Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit

20-abx495404
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Human Scavenger Receptor Class B Member 1 (SCARB1) Protein

20-abx654993
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

DLR-SCARA3-Hu-48T 48T
EUR 517
  • Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

DLR-SCARA3-Hu-96T 96T
EUR 673
  • Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

DLR-SCARA5-Hu-48T 48T
EUR 517
  • Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

DLR-SCARA5-Hu-96T 96T
EUR 673
  • Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids.

Human Scavenger receptor class A member 5(SCARA5) ELISA kit

CSB-EL020766HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Scavenger receptor class A member 5(SCARA5) ELISA kit

1-CSB-EL020766HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5(SCARA5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

20-abx153021
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Scavenger receptor class F member 2, SCARF2 ELISA KIT

ELI-18127h 96 Tests
EUR 824

Human Scavenger receptor class A member 3, SCARA3 ELISA KIT

ELI-29760h 96 Tests
EUR 824

Human Scavenger receptor class A member 5, SCARA5 ELISA KIT

ELI-35811h 96 Tests
EUR 824

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RDR-SCARA3-Hu-48Tests 48 Tests
EUR 544

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RDR-SCARA3-Hu-96Tests 96 Tests
EUR 756

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

RDR-SCARA5-Hu-48Tests 48 Tests
EUR 544

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

RDR-SCARA5-Hu-96Tests 96 Tests
EUR 756

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RD-SCARA3-Hu-48Tests 48 Tests
EUR 521

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RD-SCARA3-Hu-96Tests 96 Tests
EUR 723

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

RD-SCARA5-Hu-48Tests 48 Tests
EUR 521

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

RD-SCARA5-Hu-96Tests 96 Tests
EUR 723

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

SEH195Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

SEH195Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

SEH195Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

SEH195Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit

4-SEH195Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class A Member 5 elisa. Alternative names of the recognized antigen: NET33
  • Scavenger receptor hlg
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

ELISA kit for Mouse SCARB1 (Scavenger receptor class B member 1)

E-EL-M0427 1 plate of 96 wells
EUR 534
  • Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat SCARB1 (Scavenger receptor class B member 1)

E-EL-R2393 1 plate of 96 wells
EUR 534
  • Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat SCARB1. Standards or samples are added to the micro ELISA plate wells and combined with
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse SCARB1 (Scavenger Receptor Class B Member 1)

ELK7443 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)

KTE70476-48T 48T
EUR 332
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)

KTE70476-5platesof96wells 5 plates of 96 wells
EUR 2115
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)

KTE70476-96T 96T
EUR 539
  • Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit

20-abx495405
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Rat Scavenger Receptor Class B Member 1 (SCARB1) Protein

20-abx167677
  • EUR 718.00
  • EUR 286.00
  • EUR 2207.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (HRP)

20-abx309747
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (FITC)

20-abx309748
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (Biotin)

20-abx309749
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

DLR-SCARA3-Mu-48T 48T
EUR 527
  • Should the Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

DLR-SCARA3-Mu-96T 96T
EUR 688
  • Should the Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

20-abx154639
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Bovine Scavenger receptor class A member 5, SCARA5 ELISA KIT

ELI-29761b 96 Tests
EUR 928

Mouse Scavenger receptor class A member 5, Scara5 ELISA KIT

ELI-29762m 96 Tests
EUR 865

Mouse Scavenger receptor class A member 3, Scara3 ELISA KIT

ELI-53039m 96 Tests
EUR 865

Mouse Scavenger receptor class F member 2, Scarf2 ELISA KIT

ELI-41222m 96 Tests
EUR 865

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RDR-SCARA3-Mu-48Tests 48 Tests
EUR 557

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RDR-SCARA3-Mu-96Tests 96 Tests
EUR 774

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RD-SCARA3-Mu-48Tests 48 Tests
EUR 533

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

RD-SCARA3-Mu-96Tests 96 Tests
EUR 740

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

SEH193Mu-10x96wellstestplate 10x96-wells test plate
EUR 4862.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

SEH193Mu-1x48wellstestplate 1x48-wells test plate
EUR 488.08
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

SEH193Mu-1x96wellstestplate 1x96-wells test plate
EUR 654.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

SEH193Mu-5x96wellstestplate 5x96-wells test plate
EUR 2644.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit

4-SEH193Mu
  • EUR 4913.00
  • EUR 2595.00
  • EUR 655.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Scavenger Receptor Class A Member 3 elisa. Alternative names of the recognized antigen: CSR1
  • CSR
  • MSLR1
  • APC7
  • MSRL1
  • Macrophage Scavenger Receptor-Like 1
  • Cellular stress response gene protein
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

ELISA kit for Human SCARA5 (Scavenger Receptor Class A Member 5)

ELK4838 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class A Member 5 (SCARA5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class A Member 5 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)

KTE60747-48T 48T
EUR 332
  • Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)

KTE60747-5platesof96wells 5 plates of 96 wells
EUR 2115
  • Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)

KTE60747-96T 96T
EUR 539
  • Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) CLIA Kit

20-abx495406
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody

abx025774-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody

abx025774-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody

20-abx014841
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg
  • Shipped within 5-10 working days.

Human SCARD1(Scavenger Receptor Class D Member 1) ELISA Kit